|
|
|
|
| Modification Date/Time: | 2006-06-04 14:02:55 |
|
|
|
|
|
|
|
|
|
|
|
|
| Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG07630.1|AE004841_8 (AE004841) 50S ribosomal protein L36 [Pseudomonas aeruginosa PAO1]
Identities = 38/38 (100%), Positives = 38/38 (100%)
|
Sequence:
ATGAAAGTTCGTGCATCGGTCAAGAAGCTGTGCCGTAACTGCAAAATCATCCGTCGCGATGGCATCGTGCGG
GTGATCTGCAGCGCGGAACCGCGTCACAAGCAGCGCCAAGGCTGA |
Translation:
MKVRASVKKLCRNCKIIRRDGIVRVICSAEPRHKQRQG* |
| AnnotationID:6618 | GeneID:6617 |
|
|
| Modification Date/Time: |
2006-06-04 14:02:17 |
|
|
|
| GeneProduct: | 50S ribosomal subunit protein L36 |
|
|
|
| Cell Localization Confidence Code: | 5 |
|
|
| Functional Category: | (26) Translation, post-translational modification, degradation |
|
| Alternate Gene Product Name: | |
|
| Functional Category Confidence Code: | 5 |
|
|
| Secondary Functional Category(ies): | translation, ribosomal structure and biogenesis |
|
|
|
|
| Homology: | >gb|AAO54189.1| (AE016858) ribosomal protein L36 [Pseudomonas syringae pv. tomato
str. DC3000]
Length = 38
Score = 79.0 bits (193), Expect = 7e-15
Identities = 36/38 (94%), Positives = 38/38 (100%)
>gb|AAN66105.1|AE016238_23 (AE016775) ribosomal protein L36 [Pseudomonas putida KT2440]
Length = 38
Score = 79.0 bits (193), Expect = 7e-15
Identities = 36/38 (94%), Positives = 38/38 (100%)
>gb|AAP19382.1| (AE016992) 50S ribosomal subunit protein L36 [Shigella flexneri
2a str. 2457T]
Length = 38
Score = 77.4 bits (189), Expect = 2e-14
Identities = 33/38 (86%), Positives = 38/38 (100%) |
|
| Structural Features: | COG0257, RpmJ, Ribosomal protein L36 [Translation, ribosomal structure and biogenesis]
CD-Length = 38 residues, 100.0% aligned
Score = 43.7 bits (103), Expect = 4e-06
Identities = 28/38 (73%), Positives = 31/38 (81%) |
|
|
|
|
| GC ORFID: 49619 | How Found: Glimmer |
| GC_TrimmedSeqID: 69 | Blast Result ID |
| Subject Sequence Name: | Glimmer Score: |
| Start: 4184215 | Stop: 4184099 |
| Length: 117 | |
| Start Codon: ATG | Truncated Start: |
| Stop Codon: TGA | Truncated Stop: |
| Homolog: | Homolog Bit Score |
| Other Homologs: |
| GC ORF Sequence |
ATGAAAGTTCGTGCATCGGTCAAGAAGCTGTGCCGTAACTGCAAAATCATCCGTCGCGATGGCATCGTGCGG GTGATCTGCAGCGCGGAACCGCGTCACAAGCAGCGCCAAGGCTGA |
|