Modification Date/Time: 2006-04-06 13:01:23
Missense Discrepancy: FALSE
Comments:Inactivated 1/02/06. PA14_25300 and PA14_25310 replaced by PA14_25305 (GeneID 7375). Homology: gb|AAG06386.1| AE004724_15 (AE004724) Na+-translocating NADH:ubiquinone oxidoreductase subunit Nrq2 [Pseudomonas aeruginosa PAO1]
Identities = 71/71 (100%), Positives = 71/71 (100%)
Sequence:
ATGGCCACCGACCCGGTCTCGGCGTCCATGACCGATACCGGCAAGTGGCTGTTCGGTGCCCTGATCGGAGTG
ATGGTCATGCTGATCCGGGTGGTCAACCCGGCGTTCCCGGAAGGCATGATGCTGGCGATCCTGTTCGCCAAC
CTGTTCGCACCGCTGATCGACCATTTCGTCGTTCAGGCCAACATCAAGCGGAGGCTGGCGCGCAATGGCTAA
Translation:
MATDPVSASMTDTGKWLFGALIGVMVMLIRVVNPAFPEGMMLAILFANLFAPLIDHFVVQANIKRRLARNG*
AnnotationID:6230 GeneID:6229
Modification Date/Time:
2006-02-01 13:01:07
Cell Localization Confidence Code: 5
Alternate Gene Product Name: NADH:ubiquinone oxidoreductase, subunit B
Functional Category Confidence Code: 5
Secondary Functional Category(ies):
Homology: >gb|AAF95438.1| (AE004300) NADH:ubiquinone oxidoreductase, Na translocating,
hydrophobic membrane protein NqrB [Vibrio cholerae]
Length = 427
Score = 117 bits (292), Expect = 2e-26
Identities = 57/71 (80%), Positives = 63/71 (88%)
>emb|CAB84034.1| (AL162754) putative Na(+)-translocating NADH-ubiquinone reductase
subunit B [Neisseria meningitidis Z2491]
Length = 410
Score = 115 bits (289), Expect = 4e-26
Identities = 56/70 (80%), Positives = 63/70 (90%)
>gb|AAC21837.1| (U32702) NADH:ubiquinone oxidoreductase, subunit B (nqrB)
[Haemophilus influenzae Rd]
Length = 411
Score = 115 bits (288), Expect = 6e-26
Identities = 56/69 (81%), Positives = 62/69 (89%)
Comment: Inactivated 1/02/06. PA14_25300 and PA14_25310 replaced by PA14_25305 (GeneID 7375)