ViewGene

Locus Name:
GeneID:
Location:

GeneID:6995
TrivialName: PA14_00390
AnnotatorUID:
Modification Date/Time:2006-04-06 13:01:23
LocusName:PA14_00390
PAO1 Ortholog Locus:
Sequence Length:2178
Protein Length:725
Start: 35595
Stop: 33418
Strand: -
Type:
ChromosomeID:2
Status: INACTIVE
Frame Discrepancy: FALSE
Missense Discrepancy:FALSE
Comments:
Homology: emb|CAA55649.1| (X79027) unknown [Microbacterium ammoniaphilum]
Identities = 114/372 (30%), Positives = 135/372 (36%), Gaps = 59/372 (15%)
Sequence:
ATGCGGGGGGTGGAATACTCGTTCATCGTCACCTCTTCAAGCGCCGCCGGCCTGCAACTCGGCCTGCAGCCA
GTCGACGAAACCGTCGACCAGCCGCTGGCGCCGCTTGCGCTCCGGCAATACCGCATAGTACCCGTATCGCGA
CAGGCAGCTCTCGCCAATGGGCCGGCAAAGCAGCCCCTGTTCGAGCAGGCCGTCGACCAGGTGGCGCCAGCC
GATGGCCACGCCCTGGCCGGCGATGGCCGCCTGGATCAGCAAGGTGTAGTTGTCGAAGCTGAGCACCGCCGG
AATCGGCTGCCGATCGATGGCCAACGCTTCGAACAATGCCGGCCAGTCGAACCAGCGGGCGTGCTGCGCCGG
CTTCAGATGCAGCATCGGCAGGCGCGCCAGGTGCGCCTTGGCCAGCGGCAACTGCAATCCCTCGACCAGGCG
CGGGCTACAGACCGGGAACACCTCCTCGCGAAACAGCCGGTGCGCTTCGCCGTGCTTGGAACGACCGTCGCC
GAACAGGATCGCCACGTCGATATCGCCGCGCTGGCCGGCCAGGCCGCGCTCGCTGGTCACCAGGCTCACGTC
CAGGTGCGGATGGGCCTGGTGGAAGCGCGGAAGGCGCGGCATCAGCCAGTAGGCGGCGAAGGCGTAGTCGGT
GGCCACCTGGAGCACCTCGTGGCGCTGGCGCGCGCCCAGCGCGGCGATGCCGGCATCGATCGTCTCGAGGCC
GGCGGCCACGTGGCGGAGCAGGAGCTGGCCGGCGTCGGTGAGCACGATGCCTCGATGAACGCGCTGGAACAG
AGGGGTCGCCAGCTCCTTCTCCAGGCGTTTGATCTGCTGGCTGACCGCAGGCTGGGTGGTCCCCAGCTCCTC
GGCGGCAGCGGTGAAGCTGAGTTGGCGGGCGGCGGACTCGAATACCCGGAGCAGGTCGAGGGATGGCGGCAT
GAGGCGTTCTCCCATAAGCCAGGCTTATCCAACGCATCCAGCCCCATGCGGTTTACCAGGGATTTCGATGCA
CTGATGATCGACGCAGCACTATCGCATAACCCAATCGCATGGGATAAGCCGCCCGATGAAGACCTCGCCGAA
CATCCTGTTCATCATGGCCGACCAGATGGCCGCGCCGCTGCTGCCGCTTCACGATCCGCGCTCGGTGCTGCG
CATGCCTCACCTCTCGCGCCTCGCCGAACGGGCCGTGGTGTTCGACTCGGCGTACTGCAACAGCCCGCTCTG
CGCGCCGTCGCGCTTCACCCTGGTCAGCGGTCGCTTGCCTACTCGCATCGGCGCCTGGGACAACGCCGCCGA
CTTCGCCGCCGATACCCCCACCTACGCCCACTACCTGCGCAACCTCGGCTATCGCACGGCGCTGTCGGGCAA
GATGCACTTCTGCGGTCCCGACCAGTTGCACGGCTACGAGGAACGCCTGACCAGCGACATCTATCCGGCGGA
CTATGGCTGGGCGGTGAACTGGGACGAGCCGGAGGTGCGCCCGAGCTGGTACCACAACATGTCCTCGGTTTT
GCAGGCCGGTCCCTGCGTGCGCACCAACCAGCTGGACTTCGACGAGGAGGTGGTGTTCAAGGCCCGCCAGTA
CCTCTACGACCATGTTCGCCAGCACGCCGGCCAGCCATTCTGCCTGACCGTGTCGATGACCCATCCGCACGA
CCCCTACAGCATCCCGGCGAGCTACTGGAATCTCTACCGCGACGAGGACATCCCGCTGCCGCGCCAGCGCTT
CGCCCAGGAGGAGCAGGACCCTCATTCGCAACGCCTGCTGAAGGTCATCGACCTGTGGGACAAGCCGTTGCC
CGAGGAGCGCATCCGCGCCGCCCGGCGTGCCTACTTCGGCGCCTGCAGCTACGTCGACGCGCAGATCGGTGC
GCTGCTGGCGACCCTGGAGGAATGCGGGCTGGCCGACGACACCATCGTGGTGTTCTCCGGCGACCATGGCGA
CATGCTCGGCGAGCGCGGCCTCTGGTACAAGATGCACTGGTTCGAGATGGCCGCGCGCGTGCCGCTGCTGGT
CCATGCGCCGGCGCGCTTCGCGCCGCGCCGCATCGGCGCTTCGGTATCCACCGTGGACCTGCTGCCGACCCT
GGTGGAGCTGGCCGGCGGCCAGGTCGATCCACGCCTGCCGCTGGAAGGCCGCTCGCTGCTGCCGCACCTGCG
CGACGGCAGCGGGCATGA
Translation:
MRGVEYSFIVTSSSAAGLQLGLQPVDETVDQPLAPLALRQYRIVPVSRQAALANGPAKQPLFEQAVDQVAPA
DGHALAGDGRLDQQGVVVEAEHRRNRLPIDGQRFEQCRPVEPAGVLRRLQMQHRQARQVRLGQRQLQSLDQA
RATDREHLLAKQPVRFAVLGTTVAEQDRHVDIAALAGQAALAGHQAHVQVRMGLVEARKARHQPVGGEGVVG
GHLEHLVALARAQRGDAGIDRLEAGGHVAEQELAGVGEHDASMNALEQRGRQLLLQAFDLLADRRLGGPQLL
GGSGEAELAGGGLEYPEQVEGWRHEAFSHKPGLSNASSPMRFTRDFDALMIDAALSHNPIAWDKPPDEDLAE
HPVHHGRPDGRAAAAASRSALGAAHASPLAPRRTGRGVRLGVLQQPALRAVALHPGQRSLAYSHRRLGQRRR
LRRRYPHLRPLPAQPRLSHGAVGQDALLRSRPVARLRGTPDQRHLSGGLWLGGELGRAGGAPELVPQHVLGF
AGRSLRAHQPAGLRRGGGVQGPPVPLRPCSPARRPAILPDRVDDPSARPLQHPGELLESLPRRGHPAAAPAL
RPGGAGPSFATPAEGHRPVGQAVARGAHPRRPACLLRRLQLRRRADRCAAGDPGGMRAGRRHHRGVLRRPWR
HARRARPLVQDALVRDGRARAAAGPCAGALRAAPHRRFGIHRGPAADPGGAGRRPGRSTPAAGRPLAAAAPA
RRQRA*
AnnotationID:6996GeneID:6995
AnnotatorUID: diggins
Modification Date/Time: 2005-03-22 13:01:47
Gene Name:
Confidence Code:4
GeneProduct:conserved hypothetical protein
Cell Localization:()
Synonyms:
Cell Localization Confidence Code:5
MolecularFunction:
Functional Category:(14) Hypothetical, unclassified, unknown
Alternate Gene Product Name:
Functional Category Confidence Code:5
COGs:
Secondary Functional Category(ies):
EC Number:
Status:ACTIVE
Pathway:
Homology:
Structural Features:
CDD Search: No hits above 0.01 threshold.
Genomic Context:
Comment:
ReferenceID:13670
Author/Investigator(s): GenNotator
Title:
PubMed:
MedLine:
Source:
Reference Type:BLASTP
Data:
URL:
ReferenceID:31065
Author/Investigator(s): GenNotator
Title: CDD Search
PubMed:
MedLine:
Source:
Reference Type:RPSBLAST
Data:
URL:
GC ORFID: 49997How Found: Glimmer
GC_TrimmedSeqID: 69Blast Result ID
Subject Sequence Name: Glimmer Score:
Start: 5836932Stop: 5834755
Length: 2178
Start Codon: ATGTruncated Start:
Stop Codon: TGATruncated Stop:
Homolog: Homolog Bit Score
Other Homologs:
GC ORF Sequence
ATGCGGGGGGTGGAATACTCGTTCATCGTCACCTCTTCAAGCGCCGCCGGCCTGCAACTCGGCCTGCAGCCA
GTCGACGAAACCGTCGACCAGCCGCTGGCGCCGCTTGCGCTCCGGCAATACCGCATAGTACCCGTATCGCGA
CAGGCAGCTCTCGCCAATGGGCCGGCAAAGCAGCCCCTGTTCGAGCAGGCCGTCGACCAGGTGGCGCCAGCC
GATGGCCACGCCCTGGCCGGCGATGGCCGCCTGGATCAGCAAGGTGTAGTTGTCGAAGCTGAGCACCGCCGG
AATCGGCTGCCGATCGATGGCCAACGCTTCGAACAATGCCGGCCAGTCGAACCAGCGGGCGTGCTGCGCCGG
CTTCAGATGCAGCATCGGCAGGCGCGCCAGGTGCGCCTTGGCCAGCGGCAACTGCAATCCCTCGACCAGGCG
CGGGCTACAGACCGGGAACACCTCCTCGCGAAACAGCCGGTGCGCTTCGCCGTGCTTGGAACGACCGTCGCC
GAACAGGATCGCCACGTCGATATCGCCGCGCTGGCCGGCCAGGCCGCGCTCGCTGGTCACCAGGCTCACGTC
CAGGTGCGGATGGGCCTGGTGGAAGCGCGGAAGGCGCGGCATCAGCCAGTAGGCGGCGAAGGCGTAGTCGGT
GGCCACCTGGAGCACCTCGTGGCGCTGGCGCGCGCCCAGCGCGGCGATGCCGGCATCGATCGTCTCGAGGCC
GGCGGCCACGTGGCGGAGCAGGAGCTGGCCGGCGTCGGTGAGCACGATGCCTCGATGAACGCGCTGGAACAG
AGGGGTCGCCAGCTCCTTCTCCAGGCGTTTGATCTGCTGGCTGACCGCAGGCTGGGTGGTCCCCAGCTCCTC
GGCGGCAGCGGTGAAGCTGAGTTGGCGGGCGGCGGACTCGAATACCCGGAGCAGGTCGAGGGATGGCGGCAT
GAGGCGTTCTCCCATAAGCCAGGCTTATCCAACGCATCCAGCCCCATGCGGTTTACCAGGGATTTCGATGCA
CTGATGATCGACGCAGCACTATCGCATAACCCAATCGCATGGGATAAGCCGCCCGATGAAGACCTCGCCGAA
CATCCTGTTCATCATGGCCGACCAGATGGCCGCGCCGCTGCTGCCGCTTCACGATCCGCGCTCGGTGCTGCG
CATGCCTCACCTCTCGCGCCTCGCCGAACGGGCCGTGGTGTTCGACTCGGCGTACTGCAACAGCCCGCTCTG
CGCGCCGTCGCGCTTCACCCTGGTCAGCGGTCGCTTGCCTACTCGCATCGGCGCCTGGGACAACGCCGCCGA
CTTCGCCGCCGATACCCCCACCTACGCCCACTACCTGCGCAACCTCGGCTATCGCACGGCGCTGTCGGGCAA
GATGCACTTCTGCGGTCCCGACCAGTTGCACGGCTACGAGGAACGCCTGACCAGCGACATCTATCCGGCGGA
CTATGGCTGGGCGGTGAACTGGGACGAGCCGGAGGTGCGCCCGAGCTGGTACCACAACATGTCCTCGGTTTT
GCAGGCCGGTCCCTGCGTGCGCACCAACCAGCTGGACTTCGACGAGGAGGTGGTGTTCAAGGCCCGCCAGTA
CCTCTACGACCATGTTCGCCAGCACGCCGGCCAGCCATTCTGCCTGACCGTGTCGATGACCCATCCGCACGA
CCCCTACAGCATCCCGGCGAGCTACTGGAATCTCTACCGCGACGAGGACATCCCGCTGCCGCGCCAGCGCTT
CGCCCAGGAGGAGCAGGACCCTCATTCGCAACGCCTGCTGAAGGTCATCGACCTGTGGGACAAGCCGTTGCC
CGAGGAGCGCATCCGCGCCGCCCGGCGTGCCTACTTCGGCGCCTGCAGCTACGTCGACGCGCAGATCGGTGC
GCTGCTGGCGACCCTGGAGGAATGCGGGCTGGCCGACGACACCATCGTGGTGTTCTCCGGCGACCATGGCGA
CATGCTCGGCGAGCGCGGCCTCTGGTACAAGATGCACTGGTTCGAGATGGCCGCGCGCGTGCCGCTGCTGGT
CCATGCGCCGGCGCGCTTCGCGCCGCGCCGCATCGGCGCTTCGGTATCCACCGTGGACCTGCTGCCGACCCT
GGTGGAGCTGGCCGGCGGCCAGGTCGATCCACGCCTGCCGCTGGAAGGCCGCTCGCTGCTGCCGCACCTGCG
CGACGGCAGCGGGCATGA