ViewGene

Locus Name:
GeneID:
Location:

GeneID:6992
TrivialName: PA14_00330
AnnotatorUID:
Modification Date/Time:2006-04-06 13:01:23
LocusName:PA14_00330
PAO1 Ortholog Locus:
Sequence Length:1905
Protein Length:634
Start: 32074
Stop: 30170
Strand: -
Type:
ChromosomeID:2
Status: INACTIVE
Frame Discrepancy: FALSE
Missense Discrepancy:FALSE
Comments:
Homology: gb|AAK53449.1| (AY032926) unknown [Streptomyces aureofaciens]
Identities = 134/442 (30%), Positives = 159/442 (35%), Gaps = 104/442 (23%)
Sequence:
GTGGACGCGCCTGCTGCCGTTCCTCGCCTGGCTACCGGGGCTACGCCGGGGCACGCTCAGGCGCGAGGCCTG
GGTCGGCCTGAATGGCGCGATCCTGGCACTGCCGCAATCGATGGCCTATGCGCTGATCGCCGGCCTGCCAGC
GGAGTACGGCCTGTACGCGGCGATGCTGCCAGTGGCGATCGCCTGCCTGTGGGGCTCGTCGCGCTACCTGGT
GAGCGGTCCCACCGCGGCGATCTCGGTGCTGCTGTTCAGTTCGGTGGCCCCCCTGGCGCCGCTGGGCAGCCC
GCAATACGTCCAGGCCGTGCTGCTGCTGACCTTTCTCGCCGGCGCCTTCCAGTGGCTGCTCGGCGTCCTGCG
CGTCGGGTCGCTGGTCAATTTCGTCTCGCATTCGGTGATGCTCGGCTTCACCCTTGGCGCGGCGCTGCTGAT
CGTCCTCGGCCAACTGCCCTATCTTCTCGGCCTGGCCGCGAGCGGGGAGGGCGCAGCGCCGGGAAACGGCTG
GCGGCTGCTGGCGCGGTTCGCCGAGTTCGATGGCCCATCGCTGCTGGTGGGCGGCTTCAGCTTCGCGCTCAG
CCTGCTGGTCAGGCGCCTCCGACCGCGCTGGCCGGCCCTGCTGCTTGGCTTGCTGGGCGGTGCCACGCTGGT
CTGGGCGCTACCCGGGACCTTCGCCTCGGTAGCCCATGTGCAGGCCTTATCGAGTGCACTGCCGGGTTGGAA
TCCGCTGGTCTTCGATTCCCGATCGATCCTCGACCTGCTACCTGCGGCGGTGGCCTGCGGCATGCTCGGGCT
GGTCACCAGCCTGTCGATCGCCCGCGCCCTGGCCGCGCGCCAGGGAGACGCGTTCGATGCCAACCAGGAGGT
CCGCGCCCAGGGTCTGTCGAACCTGCTCGGGCCTTGGCTGTCGGCGAGCCTGTCGGCGGGTTCCTTCACCCG
CTCCGGGCTCAATCTGGAAGCCGGTGCGCGCTCCCCGCTGGCGGGTGCGTTTTCGGCGCTCTGGGTGGCCCT
GCTGGCCGTGCTCGGTGCGCGCCTGATCGAGCATGTACCGTTGCCGGCGATGGCCGCAGGCATCCTGCTGAT
CGCCTGGGGCCTGATCGACCGCCCGGCGCTCCGCGCGCTCTACCGCAGCGGCCGCGCCGAATGCCTGGTGGC
CGGCCTAACCGCCCTGGCCACGCTGCTGTTGCCGCTGCAGAACGCCATCTACGCGGGAGTGCTGGCGTCGCT
GTTCTTCTACCTGCGGCGCACCTCGACACCACGCGTACTGCGCCAGCGCAACGACGAGGAAGAGGTGCTGCG
CATCGAAGGCTCGATCTTCTTCGGCGCCTGCGACTACCTGCAACGCCTCATGCGCCAATGCGACAGGCCACG
GCTGGTGCTGGACGCCCGCCAGGTGAACTTCATCGACTTCGCCGGCGCAGTGCTGTTGCAGCAGGAAGCCCG
CCGCCTGCACGCCGAGGGACGCCGCCTGGTATTGCGCCACGCTCGCCCGCAGGTCCGCGAAGCGCTGGGCCG
GCAGGCCGACGAAGGCTGCCGCCTGCACTACGAAGGCTGACGCTCAGGGCGCCGCCGGCGATGTCGGTGCGC
TGTCGCCGGGCAGCAGTTGCGGCGATTCCCGCTGCAGCTTGTCGCGCATCATCTCCAACTGTCCAAGGGCGG
CGCGAGCCTCGTCGATTTCCTCGGCGCTGCGCTCGCCACCCTGTTCGGCCGCCTCGATCCGCGCGCGGATTT
CCGGTATCTGCTGTACGCCGCTGGTGTAGGCCTGTACCAGTTCGCGGGTCTGTCGTTCCTCGAAGGCCTGGT
ACTGCTTCGGATCGGCCAGCTCCTGAGCCGTCGCGCCCTGGCGTGGTTGCAGGCCGCCGAGCGGCGGGCTGC
GCGGGTCGCCCTCGTCGCGCAGCATCTGCATGA
Translation:
MDAPAAVPRLATGATPGHAQARGLGRPEWRDPGTAAIDGLCADRRPASGVRPVRGDAASGDRLPVGLVALPG
ERSHRGDLGAAVQFGGPPGAAGQPAIRPGRAAADLSRRRLPVAARRPARRVAGQFRLAFGDARLHPWRGAAD
RPRPTALSSRPGRERGGRSAGKRLAAAGAVRRVRWPIAAGGRLQLRAQPAGQAPPTALAGPAAWLAGRCHAG
LGATRDLRLGSPCAGLIECTAGLESAGLRFPIDPRPATCGGGLRHARAGHQPVDRPRPGRAPGRRVRCQPGG
PRPGSVEPARALAVGEPVGGFLHPLRAQSGSRCALPAGGCVFGALGGPAGRARCAPDRACTVAGDGRRHPAD
RLGPDRPPGAPRALPQRPRRMPGGRPNRPGHAAVAAAERHLRGSAGVAVLLPAAHLDTTRTAPAQRRGRGAA
HRRLDLLRRLRLPATPHAPMRQATAGAGRPPGELHRLRRRSAVAAGSPPPARRGTPPGIAPRSPAGPRSAGP
AGRRRLPPALRRLTLRAPPAMSVRCRRAAVAAIPAAACRASSPTVQGRREPRRFPRRCARHPVRPPRSARGF
PVSAVRRWCRPVPVRGSVVPRRPGTASDRPAPEPSRPGVVAGRRAAGCAGRPRRAASA*
AnnotationID:6993GeneID:6992
AnnotatorUID: diggins
Modification Date/Time: 2005-03-22 13:01:18
Gene Name:
Confidence Code:4
GeneProduct:conserved hypothetical protein
Cell Localization:()
Synonyms:
Cell Localization Confidence Code:5
MolecularFunction:
Functional Category:(14) Hypothetical, unclassified, unknown
Alternate Gene Product Name:
Functional Category Confidence Code:5
COGs:
Secondary Functional Category(ies):
EC Number:
Status:ACTIVE
Pathway:
Homology:
Structural Features:
CDD Search: No hits above 0.01 threshold.
Genomic Context:
Comment:
ReferenceID:16721
Author/Investigator(s): GenNotator
Title:
PubMed:
MedLine:
Source:
Reference Type:BLASTP
Data:
URL:
ReferenceID:31059
Author/Investigator(s): GenNotator
Title: CDD Search
PubMed:
MedLine:
Source:
Reference Type:RPSBLAST
Data:
URL:
GC ORFID: 49994How Found: Glimmer
GC_TrimmedSeqID: 69Blast Result ID
Subject Sequence Name: Glimmer Score:
Start: 5833411Stop: 5831507
Length: 1905
Start Codon: GTGTruncated Start:
Stop Codon: TGATruncated Stop:
Homolog: Homolog Bit Score
Other Homologs:
GC ORF Sequence
GTGGACGCGCCTGCTGCCGTTCCTCGCCTGGCTACCGGGGCTACGCCGGGGCACGCTCAGGCGCGAGGCCTG
GGTCGGCCTGAATGGCGCGATCCTGGCACTGCCGCAATCGATGGCCTATGCGCTGATCGCCGGCCTGCCAGC
GGAGTACGGCCTGTACGCGGCGATGCTGCCAGTGGCGATCGCCTGCCTGTGGGGCTCGTCGCGCTACCTGGT
GAGCGGTCCCACCGCGGCGATCTCGGTGCTGCTGTTCAGTTCGGTGGCCCCCCTGGCGCCGCTGGGCAGCCC
GCAATACGTCCAGGCCGTGCTGCTGCTGACCTTTCTCGCCGGCGCCTTCCAGTGGCTGCTCGGCGTCCTGCG
CGTCGGGTCGCTGGTCAATTTCGTCTCGCATTCGGTGATGCTCGGCTTCACCCTTGGCGCGGCGCTGCTGAT
CGTCCTCGGCCAACTGCCCTATCTTCTCGGCCTGGCCGCGAGCGGGGAGGGCGCAGCGCCGGGAAACGGCTG
GCGGCTGCTGGCGCGGTTCGCCGAGTTCGATGGCCCATCGCTGCTGGTGGGCGGCTTCAGCTTCGCGCTCAG
CCTGCTGGTCAGGCGCCTCCGACCGCGCTGGCCGGCCCTGCTGCTTGGCTTGCTGGGCGGTGCCACGCTGGT
CTGGGCGCTACCCGGGACCTTCGCCTCGGTAGCCCATGTGCAGGCCTTATCGAGTGCACTGCCGGGTTGGAA
TCCGCTGGTCTTCGATTCCCGATCGATCCTCGACCTGCTACCTGCGGCGGTGGCCTGCGGCATGCTCGGGCT
GGTCACCAGCCTGTCGATCGCCCGCGCCCTGGCCGCGCGCCAGGGAGACGCGTTCGATGCCAACCAGGAGGT
CCGCGCCCAGGGTCTGTCGAACCTGCTCGGGCCTTGGCTGTCGGCGAGCCTGTCGGCGGGTTCCTTCACCCG
CTCCGGGCTCAATCTGGAAGCCGGTGCGCGCTCCCCGCTGGCGGGTGCGTTTTCGGCGCTCTGGGTGGCCCT
GCTGGCCGTGCTCGGTGCGCGCCTGATCGAGCATGTACCGTTGCCGGCGATGGCCGCAGGCATCCTGCTGAT
CGCCTGGGGCCTGATCGACCGCCCGGCGCTCCGCGCGCTCTACCGCAGCGGCCGCGCCGAATGCCTGGTGGC
CGGCCTAACCGCCCTGGCCACGCTGCTGTTGCCGCTGCAGAACGCCATCTACGCGGGAGTGCTGGCGTCGCT
GTTCTTCTACCTGCGGCGCACCTCGACACCACGCGTACTGCGCCAGCGCAACGACGAGGAAGAGGTGCTGCG
CATCGAAGGCTCGATCTTCTTCGGCGCCTGCGACTACCTGCAACGCCTCATGCGCCAATGCGACAGGCCACG
GCTGGTGCTGGACGCCCGCCAGGTGAACTTCATCGACTTCGCCGGCGCAGTGCTGTTGCAGCAGGAAGCCCG
CCGCCTGCACGCCGAGGGACGCCGCCTGGTATTGCGCCACGCTCGCCCGCAGGTCCGCGAAGCGCTGGGCCG
GCAGGCCGACGAAGGCTGCCGCCTGCACTACGAAGGCTGACGCTCAGGGCGCCGCCGGCGATGTCGGTGCGC
TGTCGCCGGGCAGCAGTTGCGGCGATTCCCGCTGCAGCTTGTCGCGCATCATCTCCAACTGTCCAAGGGCGG
CGCGAGCCTCGTCGATTTCCTCGGCGCTGCGCTCGCCACCCTGTTCGGCCGCCTCGATCCGCGCGCGGATTT
CCGGTATCTGCTGTACGCCGCTGGTGTAGGCCTGTACCAGTTCGCGGGTCTGTCGTTCCTCGAAGGCCTGGT
ACTGCTTCGGATCGGCCAGCTCCTGAGCCGTCGCGCCCTGGCGTGGTTGCAGGCCGCCGAGCGGCGGGCTGC
GCGGGTCGCCCTCGTCGCGCAGCATCTGCATGA