ViewGene

Locus Name:
GeneID:
Location:

GeneID:6991
TrivialName: PA14_00270
AnnotatorUID:
Modification Date/Time:2006-04-06 13:01:23
LocusName:PA14_00270
PAO1 Ortholog Locus:
Sequence Length:1959
Protein Length:652
Start: 27619
Stop: 25661
Strand: -
Type:
ChromosomeID:2
Status: INACTIVE
Frame Discrepancy: FALSE
Missense Discrepancy:FALSE
Comments:
Homology: gb|AAK22724.1| (AE005749) hypothetical protein [Caulobacter crescentus CB15]
Identities = 59/213 (27%), Positives = 81/213 (38%), Gaps = 19/213 (8%)
Sequence:
GTGATTCCTACATGTCAGATGGAAACCGATTTGAGACGTACGTCTCAAATGCGGCCTGACAACTCAGACAGT
TGCCAATTGCCGGCGCAGCGTCTCCAACACCGGCGCCGAGGCAGGACGCACGCCACGCCAGAGGAAGAATGC
CTCGGCGGCCTGCTCCACCAGCATGCCCAGGCCATCCAGGGTACGCGCCGCACCGCGTTCGGCGGCCCAGCG
GTTGAAGGCGGTCGGTTCCTTGGCATACATCATGTCGTAGCAGACGGTACGGCCGGGCTCGATCACGCTCTG
CGCCAGCGGCGGCACGTCGCCGGCAAGACTGGCCGAGGTGCCGTTGACGACCAGGTCGAAAGGCCCTTCGAC
CTCGGCGAAACCGCAGCCGCGCACCGCGCCGAGATCGGCGAATCGCTCGGCCAGGTCCACGGCCTTCCGCGC
CGTGCGGTTGGCGATCAGCAACTCCGCCGGGCACTCGCCGAGGAAGGGTTCGAGCACCCCGCGCACCGCACC
GCCGGCGCCGAGCAGGAGAACCCGCTTGCCGCGCAGCTCGACCCCGGCGTTCGCCGTCAGGTCCCGCAGCAA
GCCCGCGCCGTCGGTGTTGTCGCCGCGCAGGCGACCGTCGGCCAGGCGGATCAGGGTGTTCACCGCCCCGGC
CCGGGTGGCCCGCTCGCTCAATTCGTCCACCAGACGATAGGCCTCTTCCTTGAACGGCACGGTGACATTGGC
GCCCTTGCCCTGCTCGAAGAAGCGCCGGGCGAACCCGGGGAAATCGTCCAGCGGCGCCAGCTGCGCGTCATA
GACCAGCGCCTCGCCGGTCTGCTCGGCGAACAGGCGGTGGATCAGCGGCGACTTGCTGTGGCCGATGGGGTT
GCCGAATACGCAGTAGCGGTCCATGGGTCGTTCCTTTGCCGGGGTGGGACGGGACGAGCGGACTCGTCCCCT
GCGGGCGGGTCAGGGCTGGCCGGCGAGCCAATCGCGGTCGGCGAGGAAATACTCGGTCAGGCGCGCTTCCTC
GCTGCCCGGCTCGGGTTTCCAGTCATAGCCCCAGCGCACCTGCGGCGGCAACGACATCAGGATCGATTCGGT
ACGGCCGCCGGACTGCAGGCCGAACAGGGTGCCACGATCGAAGACCAGGTTGAACTCCACGTAGCGACCGCG
ACGATAGGCCTGGAACTCTCGCTGCCGTTCATCGAACGGCGTGTGCTTGCGGCGCTGGACGATCGGCAGGTA
GGCGTCGATATAGGCGTCGCCGATAGCGCGGATGAAGGCGAAGCAGGTGTCGAAGTCCCACTGGTTGAGGTC
GTCGAAGAACAGGCCGCCGATGCCGCGCGGCTCGTTGCGGTGCTTGAGATGGAAGTAGCGGTCGCACCATTC
CTTGTAGCGCGGATAGACGTCCGCGCCGAACGGCGCGCAGGCGTCGCGAGCGACCCGGTGCCAATGCACGCA
GTCTTCCTCGTGGGCGTAGTAGGGGGTCAGGTCGAAGCCGCCGCCGAACCACCAGACCGGCTCCTCGCCTTC
CTTCTCGGCGCAGAAGAAACGCACGTTGGCATGGGAAGTCGGCACGTGGGGGTTTTCCGGATGGATCACCAG
CGACACGCCGAGCGCCTGGAAACCGCGCCCGGCCAGTTCCGGCCGATGGGCGCTGGCCGAGGGCGGCAGGCT
ATCGCCGAAGACGTGGGAAAAATTCACCCCGCCCTTCTCGATCAATGCGCCGTCGCCGATTACCCGCGTCCG
TCCGCCGCCACCGGCCGGACGCTCCCAGGCGTCCTCGGCGAAGCGGGCCTTGCCGTCCTCCGCCTCGAGGGC
GGCGCAGATGCGGTCTTGCAGGTCGAGCAGGTAGGTTTTGACAGCGGCGATACGGTCGGTCACGGAGTTCAC
CTTGGAGCGGGGAGGCCGCGCGGGGCGCGGGCTGGCGACGAAACGAGGGCGCAAGCATACCACCCTGGATGG
GTAGCCGGCGCTTGA
Translation:
MIPTCQMETDLRRTSQMRPDNSDSCQLPAQRLQHRRRGRTHATPEEECLGGLLHQHAQAIQGTRRTAFGGPA
VEGGRFLGIHHVVADGTAGLDHALRQRRHVAGKTGRGAVDDQVERPFDLGETAAAHRAEIGESLGQVHGLPR
RAVGDQQLRRALAEEGFEHPAHRTAGAEQENPLAAQLDPGVRRQVPQQARAVGVVAAQATVGQADQGVHRPG
PGGPLAQFVHQTIGLFLERHGDIGALALLEEAPGEPGEIVQRRQLRVIDQRLAGLLGEQAVDQRRLAVADGV
AEYAVAVHGSFLCRGGTGRADSSPAGGSGLAGEPIAVGEEILGQARFLAARLGFPVIAPAHLRRQRHQDRFG
TAAGLQAEQGATIEDQVELHVATATIGLELSLPFIERRVLAALDDRQVGVDIGVADSADEGEAGVEVPLVEV
VEEQAADAARLVAVLEMEVAVAPFLVARIDVRAERRAGVASDPVPMHAVFLVGVVGGQVEAAAEPPDRLLAF
LLGAEETHVGMGSRHVGVFRMDHQRHAERLETAPGQFRPMGAGRGRQAIAEDVGKIHPALLDQCAVADYPRP
SAATGRTLPGVLGEAGLAVLRLEGGADAVLQVEQVGFDSGDTVGHGVHLGAGRPRGARAGDETRAQAYHPGW
VAGA*
AnnotationID:6992GeneID:6991
AnnotatorUID: diggins
Modification Date/Time: 2005-03-22 13:01:34
Gene Name:
Confidence Code:4
GeneProduct:hypothetical protein
Cell Localization:()
Synonyms:
Cell Localization Confidence Code:5
MolecularFunction:
Functional Category:(14) Hypothetical, unclassified, unknown
Alternate Gene Product Name:
Functional Category Confidence Code:5
COGs:
Secondary Functional Category(ies):
EC Number:
Status:ACTIVE
Pathway:
Homology:
Structural Features:
CDD Search: No hits above 0.01 threshold.
Genomic Context:
Comment:
ReferenceID:16719
Author/Investigator(s): GenNotator
Title:
PubMed:
MedLine:
Source:
Reference Type:BLASTP
Data:
URL:
ReferenceID:31057
Author/Investigator(s): GenNotator
Title: CDD Search
PubMed:
MedLine:
Source:
Reference Type:RPSBLAST
Data:
URL:
GC ORFID: 49993How Found: Glimmer
GC_TrimmedSeqID: 69Blast Result ID
Subject Sequence Name: Glimmer Score:
Start: 5828956Stop: 5826998
Length: 1959
Start Codon: GTGTruncated Start:
Stop Codon: TGATruncated Stop:
Homolog: Homolog Bit Score
Other Homologs:
GC ORF Sequence
GTGATTCCTACATGTCAGATGGAAACCGATTTGAGACGTACGTCTCAAATGCGGCCTGACAACTCAGACAGT
TGCCAATTGCCGGCGCAGCGTCTCCAACACCGGCGCCGAGGCAGGACGCACGCCACGCCAGAGGAAGAATGC
CTCGGCGGCCTGCTCCACCAGCATGCCCAGGCCATCCAGGGTACGCGCCGCACCGCGTTCGGCGGCCCAGCG
GTTGAAGGCGGTCGGTTCCTTGGCATACATCATGTCGTAGCAGACGGTACGGCCGGGCTCGATCACGCTCTG
CGCCAGCGGCGGCACGTCGCCGGCAAGACTGGCCGAGGTGCCGTTGACGACCAGGTCGAAAGGCCCTTCGAC
CTCGGCGAAACCGCAGCCGCGCACCGCGCCGAGATCGGCGAATCGCTCGGCCAGGTCCACGGCCTTCCGCGC
CGTGCGGTTGGCGATCAGCAACTCCGCCGGGCACTCGCCGAGGAAGGGTTCGAGCACCCCGCGCACCGCACC
GCCGGCGCCGAGCAGGAGAACCCGCTTGCCGCGCAGCTCGACCCCGGCGTTCGCCGTCAGGTCCCGCAGCAA
GCCCGCGCCGTCGGTGTTGTCGCCGCGCAGGCGACCGTCGGCCAGGCGGATCAGGGTGTTCACCGCCCCGGC
CCGGGTGGCCCGCTCGCTCAATTCGTCCACCAGACGATAGGCCTCTTCCTTGAACGGCACGGTGACATTGGC
GCCCTTGCCCTGCTCGAAGAAGCGCCGGGCGAACCCGGGGAAATCGTCCAGCGGCGCCAGCTGCGCGTCATA
GACCAGCGCCTCGCCGGTCTGCTCGGCGAACAGGCGGTGGATCAGCGGCGACTTGCTGTGGCCGATGGGGTT
GCCGAATACGCAGTAGCGGTCCATGGGTCGTTCCTTTGCCGGGGTGGGACGGGACGAGCGGACTCGTCCCCT
GCGGGCGGGTCAGGGCTGGCCGGCGAGCCAATCGCGGTCGGCGAGGAAATACTCGGTCAGGCGCGCTTCCTC
GCTGCCCGGCTCGGGTTTCCAGTCATAGCCCCAGCGCACCTGCGGCGGCAACGACATCAGGATCGATTCGGT
ACGGCCGCCGGACTGCAGGCCGAACAGGGTGCCACGATCGAAGACCAGGTTGAACTCCACGTAGCGACCGCG
ACGATAGGCCTGGAACTCTCGCTGCCGTTCATCGAACGGCGTGTGCTTGCGGCGCTGGACGATCGGCAGGTA
GGCGTCGATATAGGCGTCGCCGATAGCGCGGATGAAGGCGAAGCAGGTGTCGAAGTCCCACTGGTTGAGGTC
GTCGAAGAACAGGCCGCCGATGCCGCGCGGCTCGTTGCGGTGCTTGAGATGGAAGTAGCGGTCGCACCATTC
CTTGTAGCGCGGATAGACGTCCGCGCCGAACGGCGCGCAGGCGTCGCGAGCGACCCGGTGCCAATGCACGCA
GTCTTCCTCGTGGGCGTAGTAGGGGGTCAGGTCGAAGCCGCCGCCGAACCACCAGACCGGCTCCTCGCCTTC
CTTCTCGGCGCAGAAGAAACGCACGTTGGCATGGGAAGTCGGCACGTGGGGGTTTTCCGGATGGATCACCAG
CGACACGCCGAGCGCCTGGAAACCGCGCCCGGCCAGTTCCGGCCGATGGGCGCTGGCCGAGGGCGGCAGGCT
ATCGCCGAAGACGTGGGAAAAATTCACCCCGCCCTTCTCGATCAATGCGCCGTCGCCGATTACCCGCGTCCG
TCCGCCGCCACCGGCCGGACGCTCCCAGGCGTCCTCGGCGAAGCGGGCCTTGCCGTCCTCCGCCTCGAGGGC
GGCGCAGATGCGGTCTTGCAGGTCGAGCAGGTAGGTTTTGACAGCGGCGATACGGTCGGTCACGGAGTTCAC
CTTGGAGCGGGGAGGCCGCGCGGGGCGCGGGCTGGCGACGAAACGAGGGCGCAAGCATACCACCCTGGATGG
GTAGCCGGCGCTTGA