|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG07633.1|AE004841_11 (AE004841) 50S ribosomal protein L30 [Pseudomonas aeruginosa PAO1]
Identities = 58/58 (100%), Positives = 58/58 (100%)
|
Sequence:
ATGGCAACTGTCAAAGTCACTCTGGTCAAGAGCCTGAACGGCCGTCTGGCCAACCACAAGGCTTGCGTCAAG
GGTCTCGGCCTGCGTCGCATCAATCATACCGTCGAAGTTCAGGACACTCCTGAGAACCGCGGCATGATCAAC
AAGGCCTACTACCTGCTGCGTGTGGAGGGTTAA |
Translation:
MATVKVTLVKSLNGRLANHKACVKGLGLRRINHTVEVQDTPENRGMINKAYYLLRVEG* |
AnnotationID:5467 | GeneID:5462 |
|
Modification Date/Time: |
2005-04-01 18:06:19 |
|
|
|
GeneProduct: | 50S ribosomal protein L30 |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (26) Translation, post-translational modification, degradation |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | translation, ribosomal structure and biogenesis |
|
|
|
|
Homology: | >gb|AAN66102.1|AE016238_20 (AE016775) ribosomal protein L30 [Pseudomonas putida KT2440]
Length = 58
Score = 107 bits (266), Expect = 2e-23
Identities = 50/58 (86%), Positives = 55/58 (94%)
>gb|AAO54186.1| (AE016858) ribosomal protein L30 [Pseudomonas syringae pv. tomato
str. DC3000]
Length = 58
Score = 103 bits (256), Expect = 3e-22
Identities = 47/58 (81%), Positives = 53/58 (91%)
>gb|AAO09251.1|AE016799_149 (AE016799) Ribosomal protein L30/L7E [Vibrio vulnificus CMCP6]
Length = 58
Score = 82.0 bits (201), Expect = 7e-16
Identities = 39/57 (68%), Positives = 47/57 (82%) |
|
Structural Features: | COG1841, RpmD, Ribosomal protein L30/L7E
[Translation, ribosomal structure and biogenesis]
CD-Length = 55 residues, 98.2% aligned
Score = 64.7 bits (158), Expect = 2e-12
Identities = 27/54 (50%), Positives = 38/54 (70%)
pfam00327, Ribosomal_L30, Ribosomal protein L30p/L7e.
CD-Length = 53 residues, 90.6% aligned
Score = 45.2 bits (107), Expect = 2e-06
Identities = 16/48 (33%), Positives = 25/48 (52%)
|
|
|
|
|
|