Modification Date/Time: 2006-04-06 13:01:23
Missense Discrepancy: FALSE
Comments:Homology: gb|AAG03769.1| AE004475_11 (AE004475) conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
Identities = 66/66 (100%), Positives = 66/66 (100%)
Sequence:
ATGCAGATTCAACTGAACGGCGAGCCCTTCGAGCTGCCCGACGCGCAGAGCGTCGCGGACCTGCTGGCCCGC
CTGGAGCTTGGCGGCCGCCGCGTGGCCGTCGAGCTGAACCTGGATATCGTGCCGCGCAGCCAGCACGCCAGC
ACCGCGCTCAAGGATGGCGACCGCGTGGAGATCGTCCACGCCATCGGCGGCGGCTAG
Translation:
MQIQLNGEPFELPDAQSVADLLARLELGGRRVAVELNLDIVPRSQHASTALKDGDRVEIVHAIGGG*
AnnotationID:5438 GeneID:5433
Modification Date/Time:
2005-03-25 06:06:18
GeneProduct: thiamine biosynthesis protein ThiS
Cell Localization Confidence Code: 5
Functional Category: (4) Biosynthesis of cofactors, prosthetic groups and carriers
Alternate Gene Product Name:
Functional Category Confidence Code: 5
Secondary Functional Category(ies):
Homology: >gb|AAO53977.1| (AE016857) thiamine biosynthesis protein ThiS [Pseudomonas
syringae pv. tomato str. DC3000]
Length = 66
Score = 105 bits (261), Expect = 8e-23
Identities = 50/66 (75%), Positives = 58/66 (87%)
Structural Features: COG2104 , ThiS, Sulfur transfer protein involved in thiamine biosynthesis
[Coenzyme metabolism]
CD-Length = 68 residues, 97.1% aligned
Score = 82.2 bits (203), Expect = 1e-17
Identities = 37/66 (56%), Positives = 48/66 (72%)
pfam02597 , ThiS, ThiS family. ThiS (thiaminS) is a 66 aa protein
involved in sulphur transfer.
CD-Length = 63 residues, 100.0% aligned
Score = 58.0 bits (140), Expect = 2e-10
Identities = 32/65 (49%), Positives = 40/65 (61%), Gaps = 2/65 (3%)