|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG04937.1|AE004583_2 (AE004583) conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
Identities = 69/69 (100%), Positives = 69/69 (100%)
|
Sequence:
ATGGCCGCGCTCTACATCCTGATCCCCGTCGCGATCGTCATCGTCGCCATCGCCATCTACGTGTTCTTCTGG
GCGGTGGACAGCGGCCAGTACGACGATCTCGACGGCCCCGCCCACAGCATTCTCTTCGACGACGAAGACCCG
AAGCACCAGGCCGGCGTCGACGAAGCGGAGAAGCCGTCGAAACCCGAGGACCGACCGCGTGGCTGA |
Translation:
MAALYILIPVAIVIVAIAIYVFFWAVDSGQYDDLDGPAHSILFDDEDPKHQAGVDEAEKPSKPEDRPRG* |
AnnotationID:5395 | GeneID:5390 |
|
Modification Date/Time: |
2006-02-03 14:02:00 |
|
|
|
GeneProduct: | putative cytochrome oxidase maturation protein cbb3-type |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (12) Energy metabolism |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | inorganic ion transport and metabolism |
|
|
|
|
Homology: | >gb|AAN69842.1|AE016623_4 (AE016790) cytochrome oxidase maturation protein, cbb3-type
[Pseudomonas putida KT2440]
Length = 71
Score = 99.8 bits (247), Expect = 3e-21
Identities = 44/70 (62%), Positives = 57/70 (81%), Gaps = 2/70 (2%)
>gb|AAO55513.1| (AE016862) cytochrome oxidase maturation protein, cbb3-type
[Pseudomonas syringae pv. tomato str. DC3000]
Length = 67
Score = 85.9 bits (211), Expect = 5e-17
Identities = 41/63 (65%), Positives = 47/63 (74%), Gaps = 7/63 (11%)
>gb|AAN55392.1|AE015677_3 (AE015677) cytochrome oxidase maturation protein, cbb3-type
[Shewanella oneidensis MR-1]
Length = 67
Score = 62.4 bits (150), Expect = 6e-10
Identities = 30/63 (47%), Positives = 44/63 (69%), Gaps = 1/63 (1%) |
|
Structural Features: | COG3197, FixS, Uncharacterized protein, possibly involved in nitrogen fixation
[Inorganic ion transport and metabolism]
CD-Length = 58 residues, 98.3% aligned
Score = 74.9 bits (184), Expect = 2e-15
Identities = 32/57 (56%), Positives = 42/57 (73%)
pfam03597, CcoS, Cytochrome oxidase maturation protein cbb3-type.
CD-Length = 49 residues, 100.0% aligned
Score = 72.2 bits (177), Expect = 1e-14
Identities = 26/49 (53%), Positives = 34/49 (69%) |
|
|
|
|
|