|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG05258.1|AE004613_3 (AE004613) probable acyl carrier protein [Pseudomonas aeruginosa PAO1]
Identities = 78/79 (98%), Positives = 78/79 (98%)
|
Sequence:
ATGGACGACATCGAGACCAGAGTGAGGAAGCTGGTAGCCGCCCGGCTCGGCGTGGAGGAATGCGACATCCGG
CTGGACAGCGATTTCCGTAACGACTTCGGTGCCGAGTCGCTCGAGGTGGTCGAACTGGTCATGGCCCTGGAA
GCGGAGTTCGGCGTCGAGATCGCCGATGACGATGCGGAACGGATCGAGACCGTGCGCCAGGCCATCGACTAT
CTCGAGGAAGCCGTGCCGACCTGA |
Translation:
MDDIETRVRKLVAARLGVEECDIRLDSDFRNDFGAESLEVVELVMALEAEFGVEIADDDAERIETVRQAIDY
LEEAVPT* |
AnnotationID:5369 | GeneID:5364 |
|
Modification Date/Time: |
2005-03-02 07:07:07 |
|
|
|
GeneProduct: | putative acyl carrier protein |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (13) Fatty acid and phospholipid metabolism |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | secondary metabolites, biosynthesis, transport, and catabolism |
|
|
|
|
Homology: | >emb|CAD14755.1| (AL646062) PROBABLE ACYL CARRIER PROTEIN [Ralstonia solanacearum]
Length = 79
Score = 95.1 bits (235), Expect = 8e-20
Identities = 47/72 (65%), Positives = 60/72 (83%)
>emb|CAE35729.1| (BX640448) acyl carrier protein [Bordetella bronchiseptica]
Length = 79
Score = 88.2 bits (217), Expect = 9e-18
Identities = 43/73 (58%), Positives = 59/73 (80%)
>emb|CAB83361.1| (AL162752) acyl carrier protein [Neisseria meningitidis Z2491]
Length = 78
Score = 87.8 bits (216), Expect = 1e-17
Identities = 42/73 (57%), Positives = 58/73 (79%) |
|
Structural Features: | COG0236, AcpP, Acyl carrier protein
[Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]
CD-Length = 80 residues, 93.8% aligned
Score = 55.7 bits (134), Expect = 1e-09
Identities = 38/75 (50%), Positives = 56/75 (74%)
pfam00550, PP-binding, Phosphopantetheine attachment site.
CD-Length = 67 residues, 100.0% aligned
Score = 46.3 bits (110), Expect = 7e-07
Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
|
|
|
|
|
|