|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG07642.1|AE004841_20 (AE004841) 30S ribosomal protein S17 [Pseudomonas aeruginosa PAO1]
Identities = 88/88 (100%), Positives = 88/88 (100%)
|
Sequence:
ATGGCTGAAGCTCAGAAAACCGTCCGTACGCTGACCGGCCGCGTCGTCAGCGACAAAATGGACAAGACCGTC
ACCGTACTGATCGAGCGTCGCGTCAAGCACCCGATCTACGGCAAATACGTCAAGCGTTCGACCAAACTGCAC
GCACACGACGAATCCAATCAGTGCCGCATTGGTGACCTGGTCACCATTCGCGAAACCCGTCCGCTGGCCAAG
ACCAAGGCCTGGACCCTGGTTGATATCGTTGAACGCGCGGTGGAAGTCTAA |
Translation:
MAEAQKTVRTLTGRVVSDKMDKTVTVLIERRVKHPIYGKYVKRSTKLHAHDESNQCRIGDLVTIRETRPLAK
TKAWTLVDIVERAVEV* |
AnnotationID:5274 | GeneID:5269 |
|
Modification Date/Time: |
2005-04-03 11:11:16 |
|
|
|
GeneProduct: | 30S ribosomal protein S17 |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (26) Translation, post-translational modification, degradation |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | translation, ribosomal structure and biogenesis |
|
|
|
|
Homology: | >gb|AAO54177.1| (AE016858) ribosomal protein S17 [Pseudomonas syringae pv. tomato
str. DC3000]
Length = 88
Score = 163 bits (412), Expect = 2e-40
Identities = 79/88 (89%), Positives = 85/88 (96%)
>gb|AAN66093.1|AE016238_11 (AE016775) ribosomal protein S17 [Pseudomonas putida KT2440]
Length = 88
Score = 161 bits (408), Expect = 6e-40
Identities = 77/88 (87%), Positives = 86/88 (97%)
>gb|AAN53325.1|AE015473_12 (AE015473) ribosomal protein S17 [Shewanella oneidensis MR-1]
Length = 82
Score = 127 bits (318), Expect = 2e-29
Identities = 56/78 (71%), Positives = 70/78 (89%)
|
|
Structural Features: | COG0186, RpsQ, Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
CD-Length = 87 residues, 100.0% aligned
Score = 106 bits (265), Expect = 8e-25
Identities = 52/87 (59%), Positives = 66/87 (75%)
pfam00366, Ribosomal_S17, Ribosomal protein S17.
CD-Length = 69 residues, 100.0% aligned
Score = 84.2 bits (208), Expect = 3e-18
Identities = 38/69 (55%), Positives = 49/69 (71%)
|
|
|
|
|
|