|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG07647.1|AE004841_25 (AE004841) 30S ribosomal protein S19 [Pseudomonas aeruginosa PAO1]
Identities = 91/91 (100%), Positives = 91/91 (100%)
|
Sequence:
GTGCCACGTTCACTGAAAAAAGGTCCGTTTATCGATCTTCACCTGTTGAAGAAGGTCGAAGTCGCGGTGGAA
AAGAACGACCGCAAGCCGATCAAGACCTGGTCGCGTCGTTCGATGATTCTGCCGCATATGGTTGGTCTGACC
ATCGCCGTGCACAACGGCCGTCAACACGTACCGGTTCTCGTCAACGAGGACATGGTCGGCCACAAACTGGGC
GAGTTCGCCGCTACCCGCACCTACCGCGGGCATGCTGCGGACAAGAAAGCCAAGCGTTAA |
Translation:
MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPIKTWSRRSMILPHMVGLTIAVHNGRQHVPVLVNEDMVGHKLG
EFAATRTYRGHAADKKAKR* |
AnnotationID:5211 | GeneID:5206 |
|
Modification Date/Time: |
2005-04-03 12:12:44 |
|
|
|
GeneProduct: | 30S ribosomal protein S19 |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (26) Translation, post-translational modification, degradation |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | translation, ribosomal structure and biogenesis |
|
|
|
|
Homology: | >gb|AAN66088.1|AE016238_6 (AE016775) ribosomal protein S19 [Pseudomonas putida KT2440]
Length = 91
Score = 181 bits (458), Expect = 1e-45
Identities = 87/91 (95%), Positives = 88/91 (96%)
>gb|AAO54172.1| (AE016858) ribosomal protein S19 [Pseudomonas syringae pv. tomato
str. DC3000]
Length = 91
Score = 177 bits (448), Expect = 1e-44
Identities = 84/91 (92%), Positives = 87/91 (95%)
>gb|AAO09266.1|AE016799_164 (AE016799) Ribosomal protein S19 [Vibrio vulnificus CMCP6]
Length = 92
Score = 165 bits (417), Expect = 6e-41
Identities = 77/91 (84%), Positives = 84/91 (92%)
|
|
Structural Features: | COG0185, RpsS, Ribosomal protein S19
[Translation, ribosomal structure and biogenesis]
CD-Length = 93 residues, 98.9% aligned
Score = 139 bits (353), Expect = 5e-35
Identities = 66/92 (71%), Positives = 73/92 (79%), Gaps = 1/92 (1%)
pfam00203, Ribosomal_S19, Ribosomal protein S19.
CD-Length = 81 residues, 100.0% aligned
Score = 119 bits (299), Expect = 8e-29
Identities = 55/81 (67%), Positives = 66/81 (81%) |
|
|
|
|
|