|
|
|
Modification Date/Time: | 2006-04-06 13:01:23 |
|
|
|
|
|
|
|
|
|
|
|
|
Missense Discrepancy: | FALSE |
|
Comments: Homology: gb|AAG06054.1|AE004695_7 (AE004695) probable 6-pyruvoyl tetrahydrobiopterin synthase [Pseudomonas aeruginosa PAO1]
Identities = 118/118 (100%), Positives = 118/118 (100%)
|
Sequence:
GTGGAACTCTTCAAAGAATTCACCTTCGAATCCGCCCATCGCCTGCCCCACGTCCCCGAAGGCCACAAATGC
GGGCGCCTGCACGGCCACTCGTTCCGTGTCGCCATCCACATCGAAGGCGAGGTCGATCCGCATACCGGCTGG
ATCCGCGACTTCGCGGAAATCAAGGCGATCTTCAAGCCGATCTACGAGCAACTCGACCACAATTATCTGAAC
GATATTCCAGGCTTGGAAAACCCCACCAGCGAAAACCTCTGCCGCTGGATCTGGCAACAACTCAAGCCGCTG
TTGCCGGAACTCTCCAAGGTCCGCGTCCACGAAACTTGCACCAGCGGTTGCGAATATCGGGGCGATTGA |
Translation:
MELFKEFTFESAHRLPHVPEGHKCGRLHGHSFRVAIHIEGEVDPHTGWIRDFAEIKAIFKPIYEQLDHNYLN
DIPGLENPTSENLCRWIWQQLKPLLPELSKVRVHETCTSGCEYRGD* |
AnnotationID:4796 | GeneID:4791 |
|
Modification Date/Time: |
2005-03-07 18:06:53 |
|
|
|
GeneProduct: | putative 6-pyruvoyl-tetrahydropterin synthase |
|
|
|
Cell Localization Confidence Code: | 5 |
|
|
Functional Category: | (4) Biosynthesis of cofactors, prosthetic groups and carriers |
|
Alternate Gene Product Name: | |
|
Functional Category Confidence Code: | 5 |
|
|
Secondary Functional Category(ies): | |
|
|
|
|
Homology: | >gb|AAO56908.1| (AE016868) 6-pyruvoyl tetrahydrobiopterin synthase, putative
[Pseudomonas syringae pv. tomato str. DC3000]
Length = 118
Score = 233 bits (595), Expect = 1e-61
Identities = 101/118 (85%), Positives = 111/118 (94%)
>gb|AAN67954.1|AE016428_2 (AE016782) 6-pyruvoyl tetrahydrobiopterin synthase, putative
[Pseudomonas putida KT2440]
Length = 118
Score = 232 bits (591), Expect = 3e-61
Identities = 99/118 (83%), Positives = 111/118 (94%)
>gb|AAP18095.1| (AE016987) putative 6-pyruvoyl tetrahydrobiopterin synthase
[Shigella flexneri 2a str. 2457T]
Length = 120
Score = 201 bits (512), Expect = 5e-52
Identities = 89/116 (76%), Positives = 101/116 (87%)
|
|
Structural Features: | pfam01242, PTPS, 6-pyruvoyl tetrahydropterin synthase.
CD-Length = 131 residues, 97.7% aligned
Score = 149 bits (378), Expect = 6e-38
Identities = 56/127 (44%), Positives = 72/127 (56%), Gaps = 12/127 (9%)
cd00470, PTPS, 6-pyruvoyl tetrahydropterin synthase (PTPS).
CD-Length = 135 residues, 97.8% aligned
Score = 143 bits (361), Expect = 5e-36
Identities = 46/132 (34%), Positives = 70/132 (53%), Gaps = 16/132 (12%)
COG0720, 6-pyruvoyl-tetrahydropterin synthase [Coenzyme metabolism]
CD-Length = 127 residues, 98.4% aligned
Score = 130 bits (327), Expect = 5e-32
Identities = 56/127 (44%), Positives = 77/127 (60%), Gaps = 11/127 (8%)
|
|
|
Comment: | other possible gene name: ygcM |
|
|
|