NCBI Conserved Domain Search
New Search PubMed Nucleotide Protein Structure CDD Taxonomy Help?

RPS-BLAST 2.2.9 [May-01-2004] Query= local sequence: lcl|tmpseq_0 unnamed protein product (105 letters) Database: cdd.v2.00
gnl|CDD|5390 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here gnl|CDD|13919 COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only] gnl|CDD|12402 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] gnl|CDD|14107 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] gnl|CDD|14140 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]
 Domain Relatives
    .. This CD alignment includes 3D structure. To display structure, download Cn3D!
  PSSMs producing significant alignments: Score
(bits)
E
value
 
gnl|CDD|5390 cd00189, TPR, Tetratricopeptide repeat domain; typically conta... 40.1 6e-05
  gnl|CDD|13919 COG4783, COG4783, Putative Zn-dependent protease, contains TPR... 46.9 6e-07
  gnl|CDD|12402 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility ... 43.8 4e-06
  gnl|CDD|14107 COG4976, COG4976, Predicted methyltransferase (contains TPR re... 35.3 0.002
  gnl|CDD|14140 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR r... 33.8 0.005


gnl|CDD|5390, cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here
             CD-Length = 100 residues,  77.0% aligned
             Score = 40.1 bits (93), Expect = 6e-05
Query:  3    IEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVEQDPTYSAGWKLLGKARQ  62
Sbjct:  20   LEYYEKALELDPDNADAYYNLAAAYYKLGKYEEALEDYEKALELDPDNAKAYYNLGLAYY  79

Query:  63   AAGDLAGARQAWEQGLA  79
Sbjct:  80   KLGKYEEALEAYEKALE  96


gnl|CDD|13919, COG4783, COG4783, Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
             CD-Length = 484 residues, only  19.6% aligned
             Score = 46.9 bits (111), Expect = 6e-07
Query:  3    IEGLEKMLAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVEQDPTYSAGWKLLGKARQ  62
Sbjct:  360  IERLKKALALDPNSPLLQLNLAQALLKGGKPQEAIRILNRYLFNDPEDPNGWDLLAQAYA  419

Query:  63   AAGDLAGARQAWEQGLAAAATHGDKQAEKEMTVFLRKL  100
Sbjct:  420  ELGNRAEALLARAEGYALA---GRLEQAIIFLMRASQQ  454


gnl|CDD|12402, COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]
             CD-Length = 250 residues, only  26.8% aligned
             Score = 43.8 bits (103), Expect = 4e-06
Query:  20   RFGLGKGYLDAGDAERATEHLQRCVEQDPTYSAGWKLLGKARQAAGDLAGARQAWEQGLA  79
Sbjct:  38   RLQLALGYLQQGDYAQAKKNLEKALEHDPSYYLAHLVRAHYYQKLGENDLADESYRKALS  97

Query:  80   AAATHGD  86
Sbjct:  98   LAPNNGD  104


gnl|CDD|14107, COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only]
             CD-Length = 287 residues, only  19.2% aligned
             Score = 35.3 bits (81), Expect = 0.002
Query:  28   LDAGDAERATEHLQRCVEQDPTYSAGWKLLGKARQAAGDLAGARQAWEQGLAAAA  82
Sbjct:  6    AESGDAEAAAELYNQALELAPEWAAGWFRLGEYTEKAGEFDAAAAAYEEVLELDP  60


gnl|CDD|14140, COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]
             CD-Length = 257 residues, only  28.0% aligned
             Score = 33.8 bits (77), Expect = 0.005
Query:  10   LAKGVDNALLRFGLGKGYLDAGDAERATEHLQRCVEQDPTYSAGWKLLGKARQAAGDLAG  69
Sbjct:  94   IAYPKDRELLA-AQGKNQIRNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLGRFDE  152

Query:  70   ARQAWEQGLAAAA  82
Sbjct:  153  ARRAYRQALELAP  165

Citing CD-Search: Marchler-Bauer A, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler GH, Mazumder R, Nikolskaya AN, Panchenko AR, Rao BS, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, and Bryant SH (2003), "CDD: a curated Entrez database of conserved domain alignments", Nucleic Acids Res. 31:383-387.