|
||||||||
|
gnl|CDD|8310, pfam02463, SMC_N, RecF/RecN/SMC N terminal domain. This domain is found at the N terminus of SMC proteins. The SMC (structural maintenance of chromosomes) superfamily proteins have ATP-binding domains at the N- and C-termini, and two extended coiled-coil domains separated by a hinge in the middle. The eukaryotic SMC proteins form two kind of heterodimers: the SMC1/SMC3 and the SMC2/SMC4 types. These heterodimers constitute an essential part of higher order complexes, which are involved in chromatin and DNA dynamics. This family also includes the RecF and RecN proteins that are involved in DNA metabolism and recombination. CD-Length = 170 residues, 97.1% aligned Score = 75.7 bits (186), Expect = 9e-15 Query: 3 LTRVSVTAVRNLHPVTLSP--SPRINILYGDNGSGKTSVLEAIH-LLGL--ARSFRSARL 57 Sbjct: 1 LKRLEIEGFKSYAGKTVIGPFSPGFNAIVGPNGSGKSNVLDAILFVLGERSASSLRAERL 60 Query: 58 QPVIQYEEAACTVFGQ----VMLANGIASNLGISRERQGEFTIR------------IDGQ 101 Sbjct: 61 SDLIHKGSGAKPKLNSAEVTITFDNQNSGPEPLDELN-PEVTIRRRVYRDGKSEYFINGK 119 Query: 102 NARSAAQLAETLPLQLINPDS--FRLLEGA--------PKIRRQFLD 138 Sbjct: 120 RVT-KKEVQELLESAGIDIKMPYFIIAQGEVEDIASMKPKERRELLE 165 gnl|CDD|10913, COG1195, RecF, Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair] CD-Length = 363 residues, 100.0% aligned Score = 371 bits (954), Expect = 7e-104 Query: 1 MSLTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPV 60 Sbjct: 1 MYLLSLLLRNFRNYAELDLDLSPGVNVLVGENGQGKTNLLEAIYLLALGRSHRTSRDKEL 60 Query: 61 IQYEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDGQNARSAAQLAETLPLQLINP 120 Sbjct: 61 IRTGADEAEISARVQRKGREGT-LGLQISKKGRRRVRINGTKARKLAELAGHLNVVLFTP 119 Query: 121 DSFRLLEGAPKIRRQFLDWGVFHVEPRFLPVWQRLQKALRQRNSWLRHGKLDPASQAAWD 180 Sbjct: 120 EDLGLVKGSPSDRRRFLDWLLFQIEPVYLEALSNYEKLLKQRNALLKQLQGDYAWLDVWD 179 Query: 181 RELSLASDEIDAYRRSYIQALKPVFEETLAELVSLDDLTLSYYRG------WDKDRDLLE 234 Sbjct: 180 QQLAELGAEIAAARAEYLNALAPLAEKIHQLFLPELESLSIFYRGSVDVTAWEIEEDYLE 239 Query: 235 VLASSLLRDQQMGHTQAGPQRADLRIRLAGHNAAEILSRGQQKLVVCALRIAQGHLINRA 294 Sbjct: 240 ALAKRRERDLARGYTLVGPHRDDLLFRLNGKPAADFASQGQQKTLALALRLAEIELLREE 299 Query: 295 KRGQCVYLVDDLPSELDEQHRMALCRLLEDLGCQVFITCVDPQLLKDGWRTDTPVSMFHV 354 Sbjct: 300 TGEYPILLLDDVASELDDGRRAALLDTIE-LGVQVFVTTTDLEDIDDNLDENA--QMFHV 356 Query: 355 EHGKVSQ 361 Sbjct: 357 EDGKITK 363 gnl|CDD|10828, COG1106, COG1106, Predicted ATPases [General function prediction only] CD-Length = 371 residues, only 24.8% aligned Score = 46.2 bits (109), Expect = 6e-06 Query: 3 LTRVSVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAIHLLGLARSFRSARLQPVIQ 62 Sbjct: 2 IKSFKIKNFKSFRELELEDFGKINIIYGANGAGKSNLLEALYFLKGLISPGSESPIPFER 61 Query: 63 YEEAACTVFGQVMLANGIASNLGISRERQGEFTIRIDG 100 Sbjct: 62 EINIWNGSYGK------EESNLDIFFEQDKEVEIISKN 93 gnl|CDD|10293, COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] CD-Length = 908 residues, only 8.1% aligned Score = 39.3 bits (91), Expect = 7e-04 Query: 1 MSLTRVSVTAVR---NLHPVTLSPSPRINILYGDNGSGKTSVLEAIH--LLGLARSFRSA 55 Sbjct: 1 MKILRLRLKNFRSFKDIDIEKLFDSG-IFLIVGPNGAGKSSILDAITFALYGKTPRLGAF 59 Query: 56 RLQPVIQYEEAACTV 70 Sbjct: 60 SLDDLIRAGEKSASV 74 gnl|CDD|10914, COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] CD-Length = 1163 residues, only 8.9% aligned Score = 38.1 bits (88), Expect = 0.002 Query: 16 PVTLSPSPRINILYGDNGSGKTSVLEAIHL-LGL--ARSFRSARLQPVI----QYEEAAC 68 Sbjct: 17 PTEINFSPGFTAIVGPNGSGKSNIVDAIRFVLGEQSAKNLRASKMSDLIFAGSGNRKPAN 76 Query: 69 TVFGQVMLAN------GIASNLGISR--ERQGEFTIRIDGQNAR 104 Sbjct: 77 YAEVELTFDNSDNTLPLEYEEISVTRRIYRDGESEYYINGEKVR 120 gnl|CDD|13222, COG3910, COG3910, Predicted ATPase [General function prediction only] CD-Length = 233 residues, only 15.5% aligned Score = 35.7 bits (82), Expect = 0.008 Query: 7 SVTAVRNLHPVTLSPSPRINILYGDNGSGKTSVLEAI 43 Sbjct: 22 SLPAFRHLEE-RLEFRAPITFITGENGSGKSTLLEAI 57Citing CD-Search: Marchler-Bauer A, Anderson JB, DeWeese-Scott C, Fedorova ND, Geer LY, He S, Hurwitz DI, Jackson JD, Jacobs AR, Lanczycki CJ, Liebert CA, Liu C, Madej T, Marchler GH, Mazumder R, Nikolskaya AN, Panchenko AR, Rao BS, Shoemaker BA, Simonyan V, Song JS, Thiessen PA, Vasudevan S, Wang Y, Yamashita RA, Yin JJ, and Bryant SH (2003), "CDD: a curated Entrez database of conserved domain alignments", Nucleic Acids Res. 31:383-387. |
|||||||||||||||||||||||||||||||||
Help | Disclaimer | Write to the Help Desk
|